PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS70127.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WOX
Protein Properties Length: 228aa    MW: 24800.8 Da    PI: 5.954
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS70127.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox47.82.4e-151777257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l     + +++V++WFqNrR + ++
  EPS70127.1 17 RTRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLekfgPVGDANVFYWFQNRRSRSRR 77
                89*****************99****************99999****************997 PP

2Wus_type_Homeobox106.91.2e-341679265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +rtRWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G ++d+NVfyWFQNr++R+r++q
         EPS70127.1 16 VRTRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGPVGDANVFYWFQNRRSRSRRRQ 79
                       589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-141384IPR009057Homeodomain-like
PROSITE profilePS5007110.7541378IPR001356Homeobox domain
SMARTSM003892.2E-61582IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-81783IPR009057Homeodomain-like
PfamPF000466.0E-131777IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
QTPAAADSAA ATPPPVRTRW TPKPEQILIL ESIFNSGMVN PPKDETVRIR KLLEKFGPVG  60
DANVFYWFQN RRSRSRRRQR QLQAAATSAS VGGGGAGFSQ ELMAADCYYP ATFWGSSSSS  120
GIQGNINISD TNNNNNNNNS DLINFPASVL EQSPKFFYED SSCLQFRQPV ITVFINGMSM  180
DVSGGPMDVK AAFGGDFVVV HSSGTAVPIN EYGFLLEGLK PGENYFLV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069976.17e-61PREDICTED: WUSCHEL-related homeobox 11-like
TrEMBLS8EC281e-169S8EC28_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_08s0056g01200.t011e-54(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61662231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17810.23e-30WUSCHEL related homeobox 12
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]